TOR3A, Mouse, Polyclonal Antibody, Abnova™

Availablity: In stock

Catalog/Part Number: 16159576
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16159576

₦492,660.00

Sorry no inventory found for this brand at this time.

Description

Sequence: TMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRLCARDAFLSQELLYKEETLDEIAQMMVYVPKEEQLFSSQGCKSISQRINYFLS

Catalog/Part Number: 16159576 Category:

Technical Specifications

Antigen:   TOR3A

Conjugate:   Unconjugated

Formulation:   50% glycerol

Gene Accession No.:   NM_022371

Gene Alias:   ADIR|ADIR2|FLJ22345|MGC111104

Host Species:  Mouse

Quantity:   50 uL

Storage Requirements:   Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal:    Polyclonal

Target Species:   Human

Applications:    ELISA, Western Blot

Description:     Mouse polyclonal antibody raised against a partial recombinant TOR3A.

Gene:     TOR3A

Format:    Antisera

Gene Symbols:    TOR3A

Immunogen:   TOR3A (NP_071766, 298 a.a. 397 a.a) partial recombinant protein with GST tag.

Regulatory Status:    RUO

Primary or Secondary:   Primary

Gene ID (Entrez):    64222

Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews