SRD5A1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™
Catalog/Part Number:: 16165825
₦554,760.00
Description
Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF
Technical Specifications
Antigen: SRD5A1
Conjugate: Unconjugated
Formulation: In 1X PBS, pH 7.4
Gene Accession No.: NM_001047.2
Gene Symbols: SRD5A1
Immunogen: SRD5A1 (NP_001038.1, 1 a.a. ~ 259 a.a) full-length human protein.
Regulatory Status: RUO
Primary or Secondary: Primary
Gene ID (Entrez): 6715
Applications: Western Blot
Description: Rabbit polyclonal antibody raised against a full-length human SRD5A1 protein.
Gene: SRD5A1
Format: Purified
Host Species: Rabbit
Quantity: 100 ug
Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal or Polyclonal: Polyclonal
Target Species: Human
Zero(0) Reviews