SRD5A1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Availablity: In stock

Catalog/Part Number: 16165825
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16165825

₦554,760.00

Sorry no inventory found for this brand at this time.

Description

Sequence: MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF


Catalog/Part Number: 16165825 Category:

Technical Specifications

Antigen:  SRD5A1

Conjugate:  Unconjugated

Formulation:  In 1X PBS, pH 7.4

Gene Accession No.: NM_001047.2

Gene Symbols: SRD5A1

Immunogen: SRD5A1 (NP_001038.1, 1 a.a. ~ 259 a.a) full-length human protein.

Regulatory Status: RUO

Primary or Secondary: Primary

Gene ID (Entrez): 6715

Applications:  Western Blot

Description: Rabbit polyclonal antibody raised against a full-length human SRD5A1 protein.

Gene: SRD5A1

Format: Purified

Host Species: Rabbit

Quantity: 100 ug

Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal: Polyclonal

Target Species: Human


Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews