PAK4, Mouse, Polyclonal Antibody, Abnova™

Availablity: In stock

Catalog/Part Number: 16182316
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16182316

₦378,810.00

Sorry no inventory found for this brand at this time.

Description

Sequence: KTIVRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEKPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLD


Catalog/Part Number: 16182316 Category:

Technical Specifications

Antigen:  PAK4

Conjugate:  Unconjugated

Formulation: 50% glycerol

Gene Accession No.: BC002921

Gene Symbols: PAK4

Immunogen: PAK4 (AAH02921, 68 a.a. ~ 157 a.a) partial recombinant protein with GST tag.

Regulatory Status: RUO

Primary or Secondary: Primary

Gene ID (Entrez): 10298

Applications: ELISA, Western Blot

Description: Mouse polyclonal antibody raised against a partial recombinant PAK4.

Gene: PAK4

Format:  Liquid

Host Species: Mouse

Quantity: 50 uL

Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal: Polyclonal

Target Species: Human


Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews