MAN2C1, Mouse, Clone: 1G12, Abnova™

Availablity: In stock

Catalog/Part Number: 16120975
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16120975

₦575,460.00

Sorry no inventory found for this brand at this time.

Description

Sequence: HCHIDTAWLWPFKETVRKCARSWVTALQLMERNPEFIFACSQAQQLEWVKSRYPGLYSRIQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQEFGKMCSE

Catalog/Part Number: 16120975 Category:

Technical Specifications

Antigen:  MAN2C1

Clone:  1G12

Description:  Mouse monoclonal antibody raised against a partial recombinant MAN2C1.

Gene:   MAN2C1

Format:   Ascites

Gene Symbols:   MAN2C1

Immunogen:   258 a.a. ∽367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa., MAN2C1 (NP_006706.2

Quantity:  200 uL

Storage Requirements:  Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal:  Monoclonal

Target Species:  Human

Applications:   ELISA

Conjugate:   Unconjugated

Formulation:   In ascites fluid

Gene Accession No.:   NM_006715

Gene Alias:   DKFZp686E23167|MAN6A8|MANA|MANA1|MGC87979

Host Species:    Mouse

Isotype:   IgM Kappa

Regulatory Status:  RUO

Primary or Secondary:  Primary

Gene ID (Entrez):   4123


Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews