MAN2C1, Mouse, Clone: 1G12, Abnova™
Catalog/Part Number:: 16120975
₦575,460.00
Description
Sequence: HCHIDTAWLWPFKETVRKCARSWVTALQLMERNPEFIFACSQAQQLEWVKSRYPGLYSRIQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQEFGKMCSE
Technical Specifications
Antigen: MAN2C1
Clone: 1G12
Description: Mouse monoclonal antibody raised against a partial recombinant MAN2C1.
Gene: MAN2C1
Format: Ascites
Gene Symbols: MAN2C1
Immunogen: 258 a.a. ∽367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa., MAN2C1 (NP_006706.2
Quantity: 200 uL
Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal or Polyclonal: Monoclonal
Target Species: Human
Applications: ELISA
Conjugate: Unconjugated
Formulation: In ascites fluid
Gene Accession No.: NM_006715
Gene Alias: DKFZp686E23167|MAN6A8|MANA|MANA1|MGC87979
Host Species: Mouse
Isotype: IgM Kappa
Regulatory Status: RUO
Primary or Secondary: Primary
Gene ID (Entrez): 4123
Zero(0) Reviews