homeobox C8, Mouse, Polyclonal Antibody, Abnova™

Availablity: In stock

Catalog/Part Number: 16129544
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16129544

₦575,460.00

Sorry no inventory found for this brand at this time.

Description

Sequence: MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENKD


Catalog/Part Number: 16129544 Category:

Technical Specifications

Antigen:  homeobox C8

Conjugate:  Unconjugated

Formulation:  In 1X PBS, pH 7.4

Gene Accession No.:  NM_022658.3

Gene Alias:  HOX3|HOX3A

Host Species:  Mouse

Purification Method:  Protein A column

Regulatory Status:  RUO

Whole Molecule:  Y

Monoclonal or Polyclonal:  Polyclonal

Target Species:  Human

Applications:  Western Blot

Description:  Mouse polyclonal antibody raised against a full-length human HOXC8 protein.

Gene:   HOXC8

Format:  Affinity Purified

Gene Symbols:  HOXC8

Immunogen:  HOXC8 (NP_073149.1, 1 a.a. ~ 242 a.a) full-length human protein.

Quantity:  50 ug

Storage Requirements:  Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Primary or Secondary: Primary

Gene ID (Entrez):  3224


Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews