DIAPH3, Mouse, Polyclonal Antibody, Abnova™

(0 customer reviews)
Availablity: In stock
Catalog/Part Number: 16130407
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16130407

₦378,810.00

Sorry no inventory found for this brand at this time.

Description

Sequence: PDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKV


Catalog/Part Number: 16130407 Category:

Technical Specifications

Antigen:  DIAPH3

Conjugate:  Unconjugated

Formulation: 50% glycerol

Gene Accession No.:  NM_030932

Gene Alias: DKFZp434C0931|DKFZp686A13178|DRF3|Dia2|FLJ34705|diap3

Host Species:  Mouse

Quantity: 50 uL

Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal:  Polyclonal

Target Species:  Human

Applications:  ELISA, Western Blot

Description: Mouse polyclonal antibody raised against a partial recombinant DIAPH3.

Gene: DIAPH3

Format: Antisera

Gene Symbols: DIAPH3

Immunogen: DIAPH3 (NP_112194, 632 a.a. to 729 a.a) partial recombinant protein with GST tag.

Regulatory Status: RUO

Primary or Secondary: Primary

Gene ID (Entrez): 81624

Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews

Related Products