CD3G, Mouse, Polyclonal Antibody, Abnova™

(0 customer reviews)
Availablity: In stock
Catalog/Part Number: 16115794
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16115794

₦378,810.00

Sorry no inventory found for this brand at this time.

Description

Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN

Catalog/Part Number: 16115794 Category:

Technical Specifications

Antigen: CD3G

Conjugate:  Unconjugated

Formulation:   50% glycerol

Gene Accession No.:  NM_000073

Gene Alias:   CD3-GAMMA|FLJ17620|FLJ17664|FLJ79544|FLJ94613|MGC138597|T3G

Host Species:   Mouse

Quantity:  50 uL

Storage Requirements:  Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal:  Polyclonal

Target Species:  Human

Applications:  ELISA, Western Blot

Description:  Mouse polyclonal antibody raised against a partial recombinant CD3G.

Gene:  CD3G

Format:  Antisera

Gene Symbols: CD3G

Immunogen:  CD3G (NP_000064, 23 a.a. to 111 a.a) partial recombinant protein with GST tag.

Regulatory Status: RUO

Primary or Secondary:  Primary

Gene ID (Entrez):   917

Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews

Related Products