CD3G, Mouse, Clone: 2A6, Abnova™

Availablity: In stock

Catalog/Part Number: 16125794
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16125794

₦575,460.00

Sorry no inventory found for this brand at this time.

Description

Sequence: QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN


Catalog/Part Number: 16125794 Category:

Technical Specifications

Antigen:  CD3G

Clone:  2A6

Description:   Mouse monoclonal antibody raised against a partial recombinant CD3G.

Gene:  CD3G

Format:  Liquid

Gene Symbols:   CD3G

Immunogen:  CD3G (NP_000064, 23 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Quantity:  100 ug

Storage Requirements:  Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal: Monoclonal

Target Species:  Human

Applications:  ELISA

Conjugate:  Unconjugated

Formulation:  In 1X PBS, pH 7.4

Gene Accession No.:  NM_000073

Gene Alias:  CD3-GAMMA|FLJ17620|FLJ17664|FLJ79544|FLJ94613|MGC138597|T3G

Host Species:  Mouse

Isotype:  IgG2a Kappa

Regulatory Status:  RUO

Primary or Secondary:  Primary

Gene ID (Entrez):  917

Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews