BCKDHB, Rabbit, Polyclonal Antibody, Abnova™

Availablity: In stock

Catalog/Part Number: 16165430
Brand: Abnova
Supplier: FISHER SCIENTIFIC
Supplier Location: LOUGHBOROUGH, UK
Inventory Weight: unavailable
Unit of Measurement:
Inventory Brochure: unavailable

Catalog/Part Number:: 16165430

₦999,810.00

Sorry no inventory found for this brand at this time.

Description

Sequence: QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD

Catalog/Part Number: 16165430 Category:

Technical Specifications

Antigen:  BCKDHB

Conjugate:  Unconjugated

Dilution:  Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.

Gene:   BCKDHB

Format:   Liquid

Gene Symbols:  BCKDHB

Immunogen:  Recombinant protein corresponding to amino acids of human BCKDHB.

Purification Method:   Antigen affinity purification

Regulatory Status:  RUO

Primary or Secondary:  Primary

Gene ID (Entrez):  594

Applications:   Immunohistochemistry (PFA fixed), Western Blot

Description:  Rabbit polyclonal antibody raised against recombinant BCKDHB.

Formulation:  In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)

Gene Accession No.:  P21953

Gene Alias:  E1B|FLJ17880|dJ279A18.1

Host Species:   Rabbit

Isotype:  IgG

Quantity:  100 uL

Storage Requirements:   Store at 4°C. For long term storage store at -20°C.

Aliquot to avoid repeated freezing and thawing.

Monoclonal or Polyclonal:  Polyclonal

Target Species:   Human


Add a review

You must login to make reviewLogin

  1. Zero(0) Reviews