BCKDHB, Rabbit, Polyclonal Antibody, Abnova™
Catalog/Part Number:: 16165430
₦999,810.00
Description
Sequence: QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD
Technical Specifications
Antigen: BCKDHB
Conjugate: Unconjugated
Dilution: Immunohistochemistry (1:20-1:50) Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user.
Gene: BCKDHB
Format: Liquid
Gene Symbols: BCKDHB
Immunogen: Recombinant protein corresponding to amino acids of human BCKDHB.
Purification Method: Antigen affinity purification
Regulatory Status: RUO
Primary or Secondary: Primary
Gene ID (Entrez): 594
Applications: Immunohistochemistry (PFA fixed), Western Blot
Description: Rabbit polyclonal antibody raised against recombinant BCKDHB.
Formulation: In PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
Gene Accession No.: P21953
Gene Alias: E1B|FLJ17880|dJ279A18.1
Host Species: Rabbit
Isotype: IgG
Quantity: 100 uL
Storage Requirements: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Monoclonal or Polyclonal: Polyclonal
Target Species: Human
Zero(0) Reviews